SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019090 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019090
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-36
Family SCAN domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 405-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000219
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 222-261
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000432
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019090   Gene: ENSSSCG00000018014   Transcript: ENSSSCT00000019609
Sequence length 546
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:59248381:59274461:-1 gene:ENSSSCG00000018014 transcript:ENSSSCT00000019609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMEPGQALVLPLPLAKAEESPFPGPDAAPPGEPSSPETACQLFRQFPYQVMSGPHETLR
QLRKLCFQWLQPELHTKEQILEMLLLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
EDPQRLLQWISIQVLGQEVSSEKVIAASCQVGGMEPHPEVPQEQGLQPPASGPGEPPSCI
VKEESDSDQELVVAASQLPAQPEERPTRDEDLGASLLQAAPQAQWSHLDSTQKEQYWDLM
LETYGKMVSGVPGISNPKPDLTSPAGYGAELAGLHLHGSEKIPRPTCTGDRQENDKENLN
LENCRDQEPPASGEPPSQASVGGLFGEDQLKHLAAEENPPEAQESPQGEWPGAQLSPQER
SAGKRQSPRLPRAPPGEPSVQGVEERREGPQRAQPRAPMAQRVPTCRECGRTFYRNPQLI
FHQRTHTTAKTSFQCPTCKKAFPRSSNLVKHQRTHTGEKPCKCDYCGKSFSDFSGLCYHK
KTHTGEKPFKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSLCGKSFSWRSSLDKHQRSHL
GKKRFQ
Download sequence
Identical sequences ENSSSCP00000019090 ENSSSCP00000019090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]