SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020191 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020191
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 176-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-18
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 298-334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020191   Gene: ENSSSCG00000028434   Transcript: ENSSSCT00000029975
Sequence length 508
Comment pep:known scaffold:Sscrofa10.2:GL892361.2:17256:67104:-1 gene:ENSSSCG00000028434 transcript:ENSSSCT00000029975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGVSTVCCKKKVLLITIFVVEGIAVAQKTQDGQNIGIKHIPSTQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDERYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPVTDPDFTYLGGILNPIPDCQ
FELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNF
VAVYDGSSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCT
GSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIV
FVLXKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQIHD
HHCGSQAPSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQAHECPEQALE
DRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences ENSSSCP00000020191 ENSSSCP00000020191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]