SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020241 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020241
Domain Number 1 Region: 289-528
Classification Level Classification E-value
Superfamily SIS domain 5.68e-17
Family mono-SIS domain 0.014
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily SIS domain 0.000000054
Family mono-SIS domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020241   Gene: ENSSSCG00000028672   Transcript: ENSSSCT00000023781
Sequence length 625
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:118796212:118823340:1 gene:ENSSSCG00000028672 transcript:ENSSSCT00000023781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAALPITEKSNPLTQDLDKADAKEIVRLLGQCDAEI
FQEEGQVMPTYQRLYSESTLTTMVQVAGKVQEVLKEPEGGLVVLSGGGTSGRMAFLMSVS
FNQLMRGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMDNPAVFLPVLVGFNPVSMARNDPIEDWSSTFRQIAERMQKLQEKQ
EAFVLNPAIGPEGLSGCSRLKGGSATKVLLETLLLAAHKTVDRGIEASPRCLLEILRTFE
RAHQVTYSQSAKIAALMKQASTSLEKKGRVHLVGWQTLGIIAIMDGVECIHSFGADFRDI
RGFLIGDHSDMFNQKAELINQGSHFTFSQEDFLTSILPALTEVDTVVFIFTLDDNLAEVQ
TLVEQVKEKTSNIQALAHGTVGQSLPTPLKKLFPSIISITWPLLFFEYEGNFIQKFQHEL
STKWVLNTVSTGAHVLLGKILQNHTLDLRIRNSKLFWRALSMLQRFSGQPKARCIESLLQ
AIHFPQPLSDDVRAAPISFHVQAADKKEQVIPIALLSLLFRCSIPEAQAHLAGAPSVCEA
VRSALTGPGRKRNADALETLEPALP
Download sequence
Identical sequences ENSSSCP00000020241 ENSSSCP00000020241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]