SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020418 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020418
Domain Number 1 Region: 47-195
Classification Level Classification E-value
Superfamily PH domain-like 0.000043
Family Phosphotyrosine-binding domain (PTB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020418   Gene: ENSSSCG00000029313   Transcript: ENSSSCT00000024089
Sequence length 202
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:135174175:135295782:1 gene:ENSSSCG00000029313 transcript:ENSSSCT00000024089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSAVGQSNNNSD
TCAEFRIKYVGAIEKLKLSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYG
IKVSTSDQYDVLHRHALYLIIQMVCYDDGLGAGKSLLALKTTDASHEEYSLWVYQCSSLE
QAQAICKVLATAFDSVLTSEKP
Download sequence
Identical sequences ENSSSCP00000020418 ENSSSCP00000020418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]