SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020423 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000020423
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00706
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020423   Gene: ENSSSCG00000028297   Transcript: ENSSSCT00000023376
Sequence length 247
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893333.2:12830:16461:-1 gene:ENSSSCG00000028297 transcript:ENSSSCT00000023376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVXFGPAFRLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSFRSIQ
RSLSCKD
Download sequence
Identical sequences ENSSSCP00000020423 ENSSSCP00000020423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]