SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020456 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020456
Domain Number 1 Region: 223-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-77
Family Protein kinases, catalytic subunit 0.00000000275
Further Details:      
 
Domain Number 2 Region: 115-257
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-36
Family SH2 domain 0.00000291
Further Details:      
 
Domain Number 3 Region: 38-173
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-22
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020456   Gene: ENSSSCG00000027568   Transcript: ENSSSCT00000025629
Sequence length 501
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:15915885:15933527:1 gene:ENSSSCG00000027568 transcript:ENSSSCT00000025629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKRQVKEKGKDGWSPVKASTYSKEPPPLPPLVVFNHLAPPPPNTTHPDQEEHFVV
ALYNYNAMNDRDLQMLKGEKLQILKEAGDWWLAKSLTTGREGYVPSNFVARVETLEVEKW
FFRSICRRDAERQLLAPVNKVGSFLIRESETSKGTFSLSVKDVTSQGEVIKHYKIRSLDE
GGYYISPRNTFPTLQALVQHYSKKGDGLCQRLTQPCVSLAPQNPWAQDEWEIPRQSLKLV
RKLGSGQFGEVWMGYYKNNIKVAIKTLKEGTMSPEAFLGEANLMKTLQHERLVRLYAVVT
KEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIEQMNSIHRDLRAA
NILVSETLCCKIGDFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGIL
LMEMVTYGRVPYPGMSNPEVIRNLERGYRMPRPDSCPPELYNGVIAECWRSRPEERPTFE
FLQSVLEDFHTATEAQYELQP
Download sequence
Identical sequences I3LPS4
XP_003359103.1.46622 XP_013845755.1.46622 XP_020928379.1.46622 ENSSSCP00000020456 ENSSSCP00000020456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]