SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020469 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020469
Domain Number 1 Region: 218-289
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000931
Family LIM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 156-223
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000152
Family LIM domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020469   Gene: ENSSSCG00000029201   Transcript: ENSSSCT00000023963
Sequence length 328
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896299.1:26324:35700:-1 gene:ENSSSCG00000029201 transcript:ENSSSCT00000023963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGKPPTRALPLPQSLPPDFRLETTAPALSPRSSFASSSASDASKPSSPRGSLLXPALGS
PGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAAGARYQDELTALLRLTGGTGGRQEAA
RTRIREPESREDYFGTCIKCNKGIYDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEED
YLFSGFQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCVVCNKCLDGIPFTVDFSNQVY
CVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCC
CFPLDGHLLCHGCHMQRLNARQPSANYI
Download sequence
Identical sequences ENSSSCP00000020469 ENSSSCP00000020469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]