SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020492 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020492
Domain Number 1 Region: 281-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-36
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.19e-18
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 87-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000244
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020492
Domain Number - Region: 134-186
Classification Level Classification E-value
Superfamily DEATH domain 0.0895
Family DEATH domain, DD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020492   Gene: ENSSSCG00000028810   Transcript: ENSSSCT00000030083
Sequence length 454
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:25616290:25622031:1 gene:ENSSSCG00000028810 transcript:ENSSSCT00000030083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDIPAAFQKELTCLVCLNYLLDPVTLGCGHSFCWCCLCVFWDQAEEPARCPVCRQQSE
QTNLKTNLLLKNLVSIARNANLFQFLKSEEQWCGTHKEIKEIFCDADKSLLCLLCSQTDE
HGDHRHLPTEEAAEEYWERLANQMRSLWEKIQEIDRSLQKNSQGTDSLMFYAYQRGDMMR
KVYQMVPPLFQEEEIYYFDGIIKEGQKFYKLIQKRQEEMIGKKTVLRKIYKELMNMCNKP
DVELLQVSTEDLFKNTSEAAQLHIPRPLLPELHARPMSGLMDWLNHFKVKISFSNEVSNQ
HIRVFDDVRSLKYRDDGLYVSLDASPSKYFAAWGTRAFTSGKQYWEVDVDSSWDWAVGVC
RDSWLRKFDGLLSDSNRDSFLLVCVKEDNHYRLWATAPTTPLYIQKPVGRVGMFLDFHTG
SLSFVDVARRSLIWRYEDGVFTFPVKPFTCTGHL
Download sequence
Identical sequences ENSSSCP00000020492 ENSSSCP00000020492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]