SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021333 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021333
Domain Number 1 Region: 52-249
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 2.49e-63
Family ENV polyprotein, receptor-binding domain 0.00048
Further Details:      
 
Domain Number 2 Region: 476-575
Classification Level Classification E-value
Superfamily Virus ectodomain 5.11e-29
Family Virus ectodomain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021333
Domain Number - Region: 380-447
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 0.0706
Family ENV polyprotein, receptor-binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021333   Gene: ENSSSCG00000030198   Transcript: ENSSSCT00000032071
Sequence length 654
Comment pep:known chromosome:Sscrofa10.2:1:147292891:147294855:1 gene:ENSSSCG00000030198 transcript:ENSSSCT00000032071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPTLSRRHLPIRGGKPKRLKIPLSFASIAWFLTLSITPQVNGKRLVDSPNSHKPLSLTW
LLTDSGTGININSTQGEAPLGTWWPELYVCLRSVIPGLNDQATPPDVLRAYGFYVCPGPP
NNEEYCGNPQDFFCKQWSCVTSNDGNWKWPVSQQDRVSYSFVNNPTSYNQFNYGHGRWKD
WQQRVQKDVRNKQISCHSLDLDYLKISFTEKGKQENIQKWVNGMSWGIVYYGGSGRKKGS
VLTIRLRIETQMEPPVAIGPNKGLAEQGPPIQEQRPSPNPSDYNTTSGSVPTEPNITIKT
GAKLFNLIQGAFQALNSTTPEATSSCWLCLASGPPYYEGMARGGKFNVTKEHRDQCTWGS
QNKLTLTEVSGKGTCIGMVPPSHQHLCNHTKAFNRTSESQYLVPGYDRWWACNTGLTPCV
STLVFNQTKDFCVMVQIVPRVYYYPEKAVLDEYDYRYNRPKREPISLTLAVMLGLGVAAG
VGTGTAALITGPQQLEKGLSNLHRIVTEDLQALEKSVSNLEESLTSLSEVVLQNRRGLDL
LFLKEGGLCVALKEECCFYVDHSGAIRDSMSKLRERLEKRHKEKEAGQGWFEGWFNKSPW
VTTLLSALTGPLVILLLLLTVGPCLINRFVAFVREQVSAVRIMVLRQQYQGLPS
Download sequence
Identical sequences B3VQ66
ENSSSCP00000021333 ENSSSCP00000021333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]