SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022078 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022078
Domain Number 1 Region: 74-161
Classification Level Classification E-value
Superfamily Virus ectodomain 3.28e-18
Family Virus ectodomain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022078   Gene: ENSSSCG00000024269   Transcript: ENSSSCT00000025772
Sequence length 266
Comment pep:known chromosome:Sscrofa10.2:8:45102709:45103556:1 gene:ENSSSCG00000024269 transcript:ENSSSCT00000025772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADVWWYCGSPLMGILLISKLAIPSPCIRTNPNSTILRNQTSSLHPGGGSFDPKVYIDSVG
VPNKFKARNQVADGFKSALFWWSTINKNVDWINCIYYNQQRLINYTRDAIKEITEQLGPT
TQMAWENRLALDMMLAEKGGVYCCTFIPNNTTPDGTITKALHRLMTLADELSENSDINDH
FTDLLKNWFKKKWKGIASIFTPLIAVISVHVLVACCIIPCARELIQRLIETVLTTGTPSP
PSQYTPDGTIKHESQTMLKEFEEKNI
Download sequence
Identical sequences ENSSSCP00000022078 ENSSSCP00000022078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]