SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022124 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022124
Domain Number 1 Region: 65-153
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-20
Family Phosphotyrosine-binding domain (PTB) 0.064
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000022124
Domain Number - Region: 3-84
Classification Level Classification E-value
Superfamily PH domain-like 0.000307
Family Pleckstrin-homology domain (PH domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022124   Gene: ENSSSCG00000025923   Transcript: ENSSSCT00000030203
Sequence length 159
Comment pep:known chromosome:Sscrofa10.2:8:1741374:1749981:1 gene:ENSSSCG00000025923 transcript:ENSSSCT00000030203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAYKDRSERARGLRERSSLTLEDICGLEPGLAYEGLAHTLAIVCLSQAVMLGFDSREAM
CAWDARIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDLLVVARDVPPAVVGQWKLSDL
RRYGAVPNGFIFEGGTRCGYSCGSVAVRLPHGQSGSISH
Download sequence
Identical sequences ENSSSCP00000022124 ENSSSCP00000022124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]