SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022917 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022917
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily Lysozyme-like 1.26e-25
Family G-type lysozyme 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022917   Gene: ENSSSCG00000008184   Transcript: ENSSSCT00000024738
Sequence length 215
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:57654500:57664522:1 gene:ENSSSCG00000008184 transcript:ENSSSCT00000024738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVVLFGGLFALIGTSRGSQSFTYSMNSRLHPRLYHGCYGDIMTMETSGAACDINRLIS
CVDVGIHGSEMFAEMDLRALKPYRTLIKEVGLRHCVDPALIAAIISRESHGGTILLDGWD
HRGLKFGLMQLDKKIHHPVGTWDSKEHLLQAVGILTDRIKAIQKKFPTWSVTQHLKGGLS
AFKLGTESIASLTDIEDDLVNDILARAKFYKRHGF
Download sequence
Identical sequences ENSSSCP00000022917 ENSSSCP00000022917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]