SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024556 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024556
Domain Number 1 Region: 338-401
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000338
Family Ran-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024556   Gene: ENSSSCG00000025693   Transcript: ENSSSCT00000030383
Sequence length 424
Comment pep:known scaffold:Sscrofa10.2:GL894109.2:20676:33513:-1 gene:ENSSSCG00000025693 transcript:ENSSSCT00000030383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLVVPSGGGGFSGFGNSAGGKPLEGLSNGSSVTAAPPFSSSRAATEAKTTFGSVAVNG
PASSVDKKMSSPKTNGDSQQPSASGLASSTACPGNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLASIEQQHGNSGSSHSESEKNKIAVETQSPSLFGSKLQQESTFLFH
GSTTEAASEKKMEALSEKNKEPSLGAASASFNFGKKIDSSVLGSLNSGPLTGFSFSSGNS
SLFGKDTTPSKPVSSPFSAKTLETRAEGGGNECREGGDEEENDEPPKVVVTEVKEEDAFY
SKKCKLFYKKDNEFKEKGVGTLHLKHTANQKTQLLVRAETNLGGYFFFPGGTNKRNHILC
ESLS
Download sequence
Identical sequences ENSSSCP00000024556 ENSSSCP00000024556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]