SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025206 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025206
Domain Number 1 Region: 52-237
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 7.32e-62
Family ENV polyprotein, receptor-binding domain 0.00028
Further Details:      
 
Domain Number 2 Region: 459-558
Classification Level Classification E-value
Superfamily Virus ectodomain 8.34e-29
Family Virus ectodomain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025206   Gene: ENSSSCG00000020695   Transcript: ENSSSCT00000027660
Sequence length 633
Comment pep:known chromosome:Sscrofa10.2:X:95526193:95528142:1 gene:ENSSSCG00000020695 transcript:ENSSSCT00000027660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPTLSWRHLPIRGGKPKRLKIPLSFASIAWFLTLSITPQVNGKRLVDSPNSHKPLSLTW
LLTDSGTGININSTQGEAPLGTWWPELYVCLRSVIPGLNDQATRPDVLRAYGFYVCPGPP
NNEEYCGNPQDFFCKQWSCITSNDGNWKWPVSQQDRVSYSFVNNPTSYNQFNYGHLATAG
TKRCMKLDLDYLKISFTEKGKQENIQKWVNGMSWGIVYYGGSGRKKGSVLTIRLRIETQM
EPLVAIGPNKGLAEQGPPIQEQRPSPNTTSGSVPTEPNITIKTGAKLFSLIQGAFQALNS
TTPEATSSCWLCLASGPPYYEGMARGGKFNVTKEHRDQCTWGSQNKLTLTEVSGKGTCIG
RVPPSHQHLCNHTEAFNQTSESQYLVPGYDRWWACNTGLTPCVSTLVFNQTKDFCVMVQI
VPRVYYYPEKAVLDEYDYRYNRPKREPISLTLAVMLGLGVAAGVGTGTAALITGPQQLEK
GLSDLHRIVTEDLQALEKSVSNLEESLTSLSEVVLQNRRGLDLLFLKEGGLCVALKEECC
FYVDHSGAIRDSMSKLRERLEKRHKEKEAGQGWFEGWFNKSPWVTTLLSALTGPLVILLL
LLTVGPCLINRFVAFVREQVSTVRIMVLRQQYQ
Download sequence
Identical sequences ENSSSCP00000025206 ENSSSCP00000025206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]