SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025709 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025709
Domain Number 1 Region: 100-239
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000000131
Family Toll/Interleukin receptor TIR domain 0.0072
Further Details:      
 
Domain Number 2 Region: 27-89
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000707
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025709   Gene: ENSSSCG00000030358   Transcript: ENSSSCT00000030474
Sequence length 268
Comment pep:known chromosome:Sscrofa10.2:12:46564456:46576015:1 gene:ENSSSCG00000030358 transcript:ENSSSCT00000030474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGITRKRFFRELTELKTFANYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLH
RVSEQQLLEDCGIRLGVHRVRILTAAREMLHSPLPCTGSKPSGDVPDVFISYRRNSGSQL
ASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSIMSARNFVLVLSAGALDKCMQDHDCK
DWVHKEIVTALSCGKNIVPVIDGFEWPEPHTLPEDMQAVLTFNGIKWSHEYQEATIEKII
RFLQGRSSRDSSAGSDTSLEGAAPMGPT
Download sequence
Identical sequences ENSSSCP00000025709 ENSSSCP00000025709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]