SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026567 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026567
Domain Number 1 Region: 253-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-80
Family Protein kinases, catalytic subunit 0.0000000159
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 3.42e-34
Family SH2 domain 0.0000312
Further Details:      
 
Domain Number 3 Region: 70-144
Classification Level Classification E-value
Superfamily SH3-domain 2.94e-17
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026567   Gene: ENSSSCG00000026803   Transcript: ENSSSCT00000028229
Sequence length 527
Comment pep:known chromosome:Sscrofa10.2:8:40026238:40096735:-1 gene:ENSSSCG00000026803 transcript:ENSSSCT00000028229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILSTYNTIQSIFCCCCCCSVQKRQVRTQISLSSDEELSEKYTQRRRPWFSELPIKKHSN
RGRVQPSKRKPLPPLPPSEFVEEKIKVKALYDFLPREPYDLALKRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKPTNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFIKAKRNMEATIKHYQIKRNDSGQWYVAERHLFQSIPELIWYHQHNAAGLMS
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFVKEIGSGQFGVVYLGQWRAHVQVAIKA
INEGSMSEEDFIEEAKVMTKLSHSRLVQLYGVCIQRKPLYIVTEFMEHGCLLNYLRERKG
KLKKEMLLSVCQDICEGMEYLERNCFIHRDLAARNCLVSSTSIVKISDFGMTRYVLDDEY
ISSSGAKFPVKWSPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
KGFRLYRPQLAPMAIYEVMYSCWHEKPKGRPTFAELLQILTEIAETW
Download sequence
Identical sequences ENSSSCP00000026567 9823.ENSSSCP00000009400 ENSSSCP00000026567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]