SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026811 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026811
Domain Number 1 Region: 64-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 272-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000353
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 475-512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 231-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 436-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026811
Domain Number - Region: 386-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00121
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026811   Gene: ENSSSCG00000002863   Transcript: ENSSSCT00000023090
Sequence length 790
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:38565866:38578848:1 gene:ENSSSCG00000002863 transcript:ENSSSCT00000023090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRAAAGPEGAPGARAQLAVVCLVNIVLTGRLSSAVPALGEHGDPWALGAELSTEPPLL
TAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQC
SLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRG
KLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPC
SGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSD
LHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAA
QGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSREGDAGDAGEQGCFSEPQRCD
GWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGT
FHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCA
FKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVL
QNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGL
LQPAPGAALDPPAPLTDTGSPGAAGEGPPSAPIHAPEVGPSVPPPLGLRDPECRPVDKDR
KASRDPLLDNSAPVDMPREPCSAQDPHPPASTASSTLGPHPPEPLGVCRSPPPPCSPTLE
ASDDEALLVC
Download sequence
Identical sequences ENSSSCP00000026811 ENSSSCP00000026811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]