SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027322 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027322
Domain Number 1 Region: 324-479
Classification Level Classification E-value
Superfamily Kelch motif 1.2e-33
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 60-177
Classification Level Classification E-value
Superfamily POZ domain 2.72e-29
Family BTB/POZ domain 0.00063
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027322
Domain Number - Region: 539-576
Classification Level Classification E-value
Superfamily Kelch motif 0.0405
Family Kelch motif 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027322   Gene: ENSSSCG00000027155   Transcript: ENSSSCT00000025367
Sequence length 598
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL895967.2:17035:23927:1 gene:ENSSSCG00000027155 transcript:ENSSSCT00000025367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNQSPRPGTHPQSAPPXGVPQPRHPSPEAERARPRQARPTAPMEGAMQLLSREGHTVSHN
SKRHYHDAFVAMSRMRQRGLLCDIVLHVAAKEIRAHKVVLASCSPYFHAMFTNEMSESRQ
THVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQVLSPALLHRXLNGVRDACCKFLLSQLD
PSNCLGXHSCSDLLKAAHRYVLQHFVDVAKTSEGPHPQVLELVSSDSLNVPSEEDVYRAV
LSWVKHDVDARRQHVPRLMKCVRLPLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHL
LPEQRGVLGTSRTRPRRCEGAGPVLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRR
ARVGVAAVGNRPDPSSSYDGTSDLATVESYDPVTNTWQPEVSMGTRRSCLVLYAAGGYDG
ASCLNSAERYDPLTGTWTSIAAMSTRRRYVRVAMLDGNLYAVGGYDSSSHLATVEKYEPQ
VRNVPSHIPLLWSCARSPLSWPPPPIICIHPVPQTPGHGVEVXLLVVGLPPALPLMQVNS
WTPAASMLSRRSSASPPPGPXSIEKYNPRTNKWVAASCMFTRFPPPSSPTLSVSSTSL
Download sequence
Identical sequences ENSSSCP00000027322 ENSSSCP00000027322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]