SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027542 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027542
Domain Number 1 Region: 43-102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000106
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027542
Domain Number - Region: 8-45
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000175
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027542   Gene: ENSSSCG00000026028   Transcript: ENSSSCT00000029017
Sequence length 104
Comment pep:known chromosome:Sscrofa10.2:1:227692498:227703231:-1 gene:ENSSSCG00000026028 transcript:ENSSSCT00000029017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHILAAGQILQIANLSGGSQGEFSCLAQNEAGMLVQKASLVIQDYWWSVDRLATCSASC
GNRGVQQPRLRCLLNSTEVNPTHCAGKARPALQPIACNRRDCPS
Download sequence
Identical sequences ENSSSCP00000027542 ENSSSCP00000027542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]