SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027928 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027928
Domain Number 1 Region: 333-578
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-45
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 150-232
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000045
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027928   Gene: ENSSSCG00000029796   Transcript: ENSSSCT00000030396
Sequence length 636
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:38048838:38050850:1 gene:ENSSSCG00000029796 transcript:ENSSSCT00000030396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAHGVCGQAAGRGSAAEAPGEGSLQLPDAAAGEGAASPAQTPCSLSASLCFSSGDDSPPQ
SRASAADSAGASPPSRRSGQRVVERQWEVGSAGAASPEEHASPEDPVSPEEEEAVSLEEP
VSPEESTSPEEPGDPAPVPPGVGPEHGEPDLLIEVSGRRLRAHKAVLAARSDYFRARASR
DVLRVQGVSWAALRLLLAYAYTGRMAGVRPDNVAEVVAGARRLQLPCAAQRATDAVAPQL
SLSNCYEVLTAAKRQRLAELREAAYRFMSDHYLEVLREPAVFGRLSGAERDLLLRRRLRA
GRARLLAAALGPAGERAGSRPQSPSGDAEGRGDAAVYCFQEVAGEWRELTRLPEGAPARG
CGLCVLYNYLFVAGGVGPAGPDGRARPSDQVFCYNPATDRWSTVRPLRQARSQLQLLALD
GHLYAVGGECLLSVERYDPRADRWATVAPLPRGAFAVAHEATTCNGEIYVSGGSLFYRLL
KYDPRRDEWQECPCSSSRERSADMVALDGSIYRFDLCGGRGDAPAAGPAGGVSVLRYHCL
AKQWSRCASHLRPPGAPSSLQPFRCAALDGTIYCVSRAGTWRFVPPRDCEPGAGDAGQEG
SFELQSLRAPPDARGLLFPFVLNLLEKPDRGEEGAA
Download sequence
Identical sequences ENSSSCP00000027928 ENSSSCP00000026979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]