SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 69_10.2 > ENSSSCP00000029588

Domain assignment for ENSSSCP00000029588 from Sus scrofa 69_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000029588
Domain Number 1	Region: 255-306
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000288
Family	TSP-1 type 1 repeat	0.00054
Further Details:

Domain Number 2	Region: 135-184
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000484
Family	TSP-1 type 1 repeat	0.00047
Further Details:

Domain Number 3	Region: 74-130
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.00000000157
Family	TSP-1 type 1 repeat	0.0023
Further Details:

Domain Number 4	Region: 187-247
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.00000000549
Family	TSP-1 type 1 repeat	0.00079
Further Details:

Domain Number 5	Region: 309-369
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000116
Family	TSP-1 type 1 repeat	0.001
Further Details:

Domain Number 6	Region: 380-413
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000275
Family	TSP-1 type 1 repeat	0.0026
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000029588 Gene: ENSSSCG00000012278 Transcript: ENSSSCT00000035117
Sequence length	463
Comment	pep:putative chromosome:Sscrofa10.2:X:47329684:47332886:1 gene:ENSSSCG00000012278 transcript:ENSSSCT00000035117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPTQRQAPQLLLLPLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSLEDCCLNADY AFQETSSKFCMPCRPPQWSPWSAWAPCSVTCTEGSQLRHRRCVGWGGQCPENVELGTLQW QLQACENQPCCPEMGGWSSWGPWAPCSATCSRGTRTRRRACDRPTPKCGGHCPGEAQESE DCDTQQVCPTHGAWAAWGPWGPCQSTCKGGPSEPVERRKRTCTAPEPSTKPPGNPCSGSA NDQRMCSGLPPCPVAGGWGPWGAVSPCPVTCGLGQTREQRSCDHPVPQHGGPFCVGEAFR THICNTAVPCPVDGEWGLWGEWSNCVRRGIKHISCQEIPGQQTRSRICKGRKFDGRRCLG EQQDIRHCYSIQRCPLKEASWSEWSTWGLCIPPCGPSPVRTRQRLCQPKLPNFPPTITPV EGQGEKNVTFWGKPLVKCDVLQGQHMMVEEKRPCLHAPPCNEP
Download sequence
Identical sequences	A0A0B8RZN8 F1RWV1 ENSSSCP00000030234 XP_003135101.1.46622 ENSSSCP00000029588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]