SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_04246T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_04246T0
Domain Number 1 Region: 38-161
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000457
Family Ricin B-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SARC_04246T0
Sequence length 200
Comment | SARC_04246 | Sphaeroforma arctica JP610 hypothetical protein (201 aa)
Sequence
MIVPSSIMQSIVTIMAAVGCIQSFCHAQPTRQQRNTAVHYYSYRNIYHPQCMTRGTGEES
NVVMVGECDEENTLYLRYNSDTKEVLTSTGECLLSPKADDVEGYKNIQLGECNGTKLQTW
ELHKPGDSEHHLRNRDNGLCADVKHQHWDTYIVLWKCKKSNSYKHSNQGWQAFGQLMSNG
AVDYMPQERDGYVRTVERVA
Download sequence
Identical sequences A0A0L0G362
SARC_04246T0 XP_014157417.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]