SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_04850T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_04850T0
Domain Number 1 Region: 5-294
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.94e-23
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SARC_04850T0
Sequence length 514
Comment | SARC_04850 | Sphaeroforma arctica JP610 hypothetical protein (515 aa)
Sequence
MEMRVSTDGGDTWNHAHFPVEIKVKRDLALAELETTELGYQILDASEGSVFINVDNDNAD
GKGLHTGNLYTSDSSGTSYSLSLTDNLYLQSLRNDFHKVASIVGTYITNQLVIEEGTYMQ
EFRTVITFNKGGEWRPIIAPTVDSDGADVGCDECYLQLHNYVSQATMGLQPIFSLENAAG
LVIAHGTIGRYLSTNAQTSLFLSRDGGFTWTMILDGAYTFAVADHGGLLVAIPVGKKQNS
ILFSWDMGRSWESFQFTDVPITIVRVLAKPGFQTRVFNIWGNDAGGHWTITTLDFTEYLG
RPCLDADYTSWSPSDGRISNQRCVLGHKRVYKRRKNTAKCFNDVDYELETSNTSCPCTKE
DFECDYGYFRPNIDQHCVEYASFNMSTVAPCSNGEEEYVQSSGYRRVPGDSCSGGVENQY
ISSMLVSCESDKSTPLAAIVVPVVLAILAVALVAVVAYVYNRKKNYWRARYLALAQQDHD
DDIQHTGLDSESDEDSEDDELEVADLADPSKDMH
Download sequence
Identical sequences A0A0L0G216
XP_014156773.1.97753 SARC_04850T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]