SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_09839T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SARC_09839T0
Domain Number - Region: 36-129
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00873
Family Ricin B-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SARC_09839T0
Sequence length 144
Comment | SARC_09839 | Sphaeroforma arctica JP610 hypothetical protein (145 aa)
Sequence
MYEDINCESQQKFAWHPDYDNQFVALDQDLVITDHCVMLLDGSLDFTGERQAVLGDDSTD
LGDCSASNAIWETIDVDAYIKQEVVLIKDDVSGKCLQASNQQYAGNQQTPDKYSLYDCEP
ANPYQHFVLRVDCNVSPSGYQVDE
Download sequence
Identical sequences A0A0L0FLS4
SARC_09839T0 XP_014151607.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]