SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_16157T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SARC_16157T0
Domain Number - Region: 33-93
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000315
Family Ricin B-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SARC_16157T0
Sequence length 107
Comment | SARC_16157 | Sphaeroforma arctica JP610 hypothetical protein (108 aa)
Sequence
MLQATVLTGNNTEVLYRNDNQFGPFEAGNYNEWFGSNQIVKVDTDYCLQVQPGVHQGCAR
QAWTCDGWNYIGTENYRGYDTCYDSSDRWVTIESAQTVDIQTNPLCC
Download sequence
Identical sequences A0A0L0F3W5
XP_014145208.1.97753 SARC_16157T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]