SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_01637T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_01637T0
Domain Number 1 Region: 24-147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 139-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000911
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  SARC_01637T0
Domain Number - Region: 168-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0194
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SARC_01637T0
Sequence length 424
Comment | SARC_01637 | Sphaeroforma arctica JP610 hypothetical protein (425 aa)
Sequence
MNIVNMYNHLTFMYIAEQTRMNVHSARTTCGNIDGSYTCTYNSGYAGSGTTCEDVNECLA
GADNYDMNAICTNTVGSFECTCDEFHIGDGVTCIDKDECALDTHNCHSNATCTNTDGGFT
CACNSGYTGIGHTCTDINKCLVNTHNCDENAQCTNTDGSFECACDEFWTGDGLIYTDIDE
CDSAAIIECENEGDTVVCVNHVGADYTCECNPTGYRDPDNSDGFNCVAYAGDPAKCADYH
LAANCPDGTLRNSGNQGNCDPERGCAESCCTADQGYVLADDDEAVSLISDIEFRSGLPWY
FHCLGAYRLIECAVRNCQADTTAFNLSNGQLESALDTSAPNAFSAGDELDNCPTTADTDG
LGTVGEWMIRTSLGSSTNRAFILIVLPDNNPTNELAAYIYDIRQRQGSGEFNPFTSQWYI
SSYD
Download sequence
Identical sequences A0A0L0GB23
SARC_01637T0 XP_014160102.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]