SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_02605T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_02605T0
Domain Number 1 Region: 795-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 44-145
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000978
Family Ricin B-like 0.035
Further Details:      
 
Domain Number 3 Region: 264-334
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000144
Family Cysteine rich domain 0.075
Further Details:      
 
Weak hits

Sequence:  SARC_02605T0
Domain Number - Region: 506-611
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000147
Family Cysteine rich domain 0.049
Further Details:      
 
Domain Number - Region: 191-239
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00471
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 447-497
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00641
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SARC_02605T0
Sequence length 903
Comment | SARC_02605 | Sphaeroforma arctica JP610 hypothetical protein (904 aa)
Sequence
MRGFAFTVSLILAASISFVAAQDNEQQIIPAFQSVSLDNDPYENYVMRQNRTANCIGVGD
IDTSDPYPIIEPCTADLSQVWLRIADFENQGQWQNRVTQTCITVPYNGDQVILKTCSATT
LNNQKILDDALIAPRPNTATNVCLGPCADASGRLCTFEAGTVDWCAVPDTNEPAFNYELY
AEEFCQSPISEGRWEIDFYGECSTTCDTGLRPVTYVCSSLRDLEYSCCGDLPENEVPCNS
VPCGASVSNYKVIKSTASLDSPDATPLCIDAIDPTHVEMRPCAGSDSQLFIQINPKDDKQ
WVNKATGNCIQVPERYNMDKQTDFIFLRPCQDDYSDSDNFRYQQFAVDELVETRVRTCLT
PCDSLADGTLFEPSLDDLLIAGRQEEEAFFNPAADNKDAVCAVRDNDNNVTPWCQAGSFS
YLGLDLYNRRMEDQLWCQQEESAGSWQYFGEDQCSAQCDGGIQRFDYRCIPEDPNVETAC
CGTKPGESSRLCNAQPCDATLDDTWVLEDLRDRGRCATTQDDNTLTFSDCLSGAETQRFL
WLEQPRSGSSETQQWFQPSTQLCVTVLWDREGGLDQEAEVRMSNCSITPDDMQFFHKPSY
LINTAIAACLAPCTEDEDKVCAFGQEGSDWCTADVSTPKNTYMKGFKYCLQDGIDCPVDS
GLVTVTQFTTVEGPEPTFASTTTSTILVTSTEGGSSAAVSTSTSVQLTTVTQDVTVSEVT
TSTQEVTITTEDVTTTTEALVPVTSTSEVVFPVFSTSDVVTTSLGATTFNPFGDATTGVT
TGDTIAGDDTDATTGDGVDGNWSEWAECTVTCSFGIQTRECNNPAASGGGAECPGAAIRT
CNPGPCARALDMRSVDEGEVRFAESEEYKVKFNSGEGNVGNMNTKASQRRSAKLGTGQDT
GRS
Download sequence
Identical sequences A0A0L0G857
XP_014159087.1.97753 SARC_02605T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]