SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_02606T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_02606T0
Domain Number 1 Region: 1113-1164
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 323-392
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000209
Family Ricin B-like 0.089
Further Details:      
 
Domain Number 3 Region: 102-206
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000111
Family Ricin B-like 0.053
Further Details:      
 
Domain Number 4 Region: 561-683
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000163
Family Ricin B-like 0.016
Further Details:      
 
Domain Number 5 Region: 248-302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000641
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SARC_02606T0
Sequence length 1211
Comment | SARC_02606 | Sphaeroforma arctica JP610 hypothetical protein (1212 aa)
Sequence
MNFRRGVALLVLASAFDSSFAQDEGEDGGGVTNDNFVQEQPINVIDAGAFDATTDEDLAP
LVDERQVDTTDDDEDTTMVAEESKFLRPPFKSVSLDNDEFESYVIRRNGTAQCVGLTDTD
TTDPIPITEPCDGSLSQLWLRIANDENQGQWQNRMTYTCITVPYDGQESIIMKTCSATTL
NNQKILDDALIAPRPNTDSNLCITPCADDSGLLCSFEAGTEASCNIAQGTIDAYNYNLYA
EPFCDSPVSDGRWEIDLYGECSATCDSGTRPVTYTCSSLREFKYACCGDEPEEIVPCNSV
PCGANVGNYKVIKSTASLEAVDANPLCIDAVDPTHVEMRPCSGSDSQLFIQIDPKQDKQW
VNKATGNCVQVPERYNMDKTTDFIFLRPCQTDTGTSDDLRYQQFYVDELVESRVRTCLSP
CNELNNLVVEDLSAQLVSGFEEEEFFNPAPINKESVCAVRDDDEGATSWCQAGSFSYLGL
EIYNNRMEDQLWCEQENSYGEWLFFGEGSCSKTCGGGALPLDYRCIPKDINVETACCGDK
EGAGSYLCNAQPCNGTQEDIWVLLDSVDRTQCATTTDENTLVFEECTSGNAGQQFIYFEG
REGEGDSQQWYNPESGFCVTVQYPEVDDEVLQPSIVMANCSLDPMDTQFFSEPTTLVNTG
VGACLAPCDDNSTRVCAFDEDSGPWCETSSPVINQLMAAAKYCSLDNVDCTAPTTTEVTV
TSFTTVTGELPTQTSLETTQETITEIPVVTITSVVTQTGTELPPTDVTVTETTTVDGSLS
TVLPTESESITDGVTVTETTTTVDTASTDTSITDIKTETFTSATTETAPGTSFTSTTVDI
QTVTETAETTVPVTVTETSAATDTVLITSTEILPSPAPITTSVVTETITSTGAESTVTEL
ITTTEGVTTTTEITSTTLDPSTSTVTSVSFSTVTRPLTGTFTTTEVTSTTLDPSTITTTS
ISLTTETRPPEASTTTTTFVVSSTLDPSTSTETSFETETSTLPASSQQQSSTVTEVVTST
ADASTSTVTEIDITTASTSTVTDVITSTADASTSTVTEIDTVTSDGPQFPTFSSVDPSSD
ASSSASGFPTDPFVPTTSSDTETPAETSETQPDDAVDGNWSEWSDCSVTCSFGIQTRTCT
QPEPQNGGETCPGPAIRTCSPAPCSRADFDRRSVEEISLAEDEQRRIADQIVSLSLADST
SFRRQDNDKVL
Download sequence
Identical sequences A0A0L0G8I4
SARC_02606T0 XP_014159088.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]