SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_05336T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_05336T0
Domain Number 1 Region: 36-100
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000891
Family Ricin B-like 0.058
Further Details:      
 
Domain Number 2 Region: 355-404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  SARC_05336T0
Domain Number - Region: 182-229
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000353
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number - Region: 300-343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000916
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SARC_05336T0
Sequence length 713
Comment | SARC_05336 | Sphaeroforma arctica JP610 hypothetical protein (714 aa)
Sequence
MSSKDMSKNMLRAALVAATSCATCATMIAGINDFLIVTSDMKCLGIQGIEVKAQACDGST
GQYWREVNDQQLLNWDSKDCLTVNHASGVVYTSPCGDNTNTEQAYIDFRSLIVNGGKNCV
GGGECRGLCMTTEGERASAVAIESASEWCGNNGDAQYFNKKLQSVAISNIPSMVGSWVEG
SVEASGCSKKCGGGVSSVEYVCKSETFANAYCAGNRPSPVERECNTERCDDWSEYGECSA
KTCEDVGYHGRACLKENGNCPGADFKECKPAGCEAESRTEVLEVDDLKQPAKLRVAADGS
LWTDFDACSNSCGVGIQTARCADISSKAAGHPCQVYEYTQSCHDNSRPGCNYVHVEDVDG
EWRPWEACTTTCGAGIQKRQCINREGNGKDCVSDLDGDTRTCVNAEVCPEGVVSSLTGER
GEVVNNVIVRNDPQPVAANGQVRSEVGDGGPQGSRITGGMDSSGGFAVTSGGRTEESNRD
QVDGGNQQVQGSNAYANGGYNAVYSAPQTFDSQSYTGFGASTDSTFGTTGSTFGSTGSTF
GSSDTSTGFGTTSGTSTFGTTSGTNTFGTTSGANTFGTTSGTSTGFGTTTGTSTFGTTTG
TSTGFGTTSVDSFTFDDSGFEDFEDFDEEEFDDLDDFDDFDDEDWFFNAFERRRRSVDAE
DVFEQLDNVFPMSLSLLGVVCLVVASVFGTFMAIKAGSKSSHSKYREGDIFQV
Download sequence
Identical sequences A0A0L0FZY8
SARC_05336T0 XP_014156287.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]