SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470181606|ref|YP_007567481.1| from Legionella pneumophila subsp. pneumophila LPE509

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470181606|ref|YP_007567481.1|
Domain Number 1 Region: 96-437
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.39e-27
Family Bacterial lipase 0.043
Further Details:      
 
Weak hits

Sequence:  gi|470181606|ref|YP_007567481.1|
Domain Number - Region: 461-610
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0942
Family p120GAP domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470181606|ref|YP_007567481.1|
Sequence length 752
Comment hypothetical protein LPE509_00938 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Sequence
MFAEIPKIQEQLHNVLEYSQSMTSLWMQSIDKSLEQTNKVTQSLINLNQQQIYPYPNILN
DAIEYTVDFMQRSILFWDIMRKRGNQYLKHEQEGQPPVLIFSYNMLMDGRHFERPVNYAL
VEIIPPEGIQIDPAKRPYVIVDPRAGHGAGISGFKDASQVGLALRAGHPVYVIIFFPVPE
PNQTLVDVTAAHEKFLTEVALRHPQSPKPCLIGNCQGGWAILTLMAANPDVAGVAVVNGA
PLSYWGGENGKNPMRYIGGIWGGSWIAQMAGDLGNGKFDGANLVMNFEMANPKVTYWSKY
YNLFANLDKEEIRFLNFERWWGGFSLLNVNEMRGIIDNLFIGNKLVHGKIPLGQSGNNLD
LRNISVPVIIFCSEGDNITPPQQALNWVSDLYSNTLEIKLDGQVIVYLIHKSVGHLGIFV
SSEVAKKEHNQIIDLLNYIEHLAPGLYELKLNETKENPKSPPHYLAYIEERSINDIRKGQ
ESNVAIFNLVRMVSEYNAMSYDLFMAPIIRNISNEYTAELIRKLHPLRQNQYLLSDLNPL
VHPVSWISPFIRQNRIKISENNPFLTQQLNFSKLINALWDFFSASRDNTVELMFYAVYGY
IQLLAPFDPRRDMIVHSPEKDNQEKITQSIIAHISDGGVPEAILRILLLLVKIQGYIIGA
NLPDVIQKLRECNALKHLDKNGFKQIVHSQTIMIEHDPELAFNTIPHLLKSQEERSMVIQ
FIEDILKSLKVSPSEEYKKKFQRIKELLQNQV
Download sequence
Identical sequences A0A2J9NHE6 G8UYE4 Q5ZTK0
272624.lpg2161 gi|378778063|ref|YP_005186501.1| gi|470181606|ref|YP_007567481.1| WP_010947872.1.100881 WP_010947872.1.101385 WP_010947872.1.10160 WP_010947872.1.11666 WP_010947872.1.1188 WP_010947872.1.12035 WP_010947872.1.14235 WP_010947872.1.15016 WP_010947872.1.16078 WP_010947872.1.16593 WP_010947872.1.16748 WP_010947872.1.16962 WP_010947872.1.17857 WP_010947872.1.19321 WP_010947872.1.19554 WP_010947872.1.20369 WP_010947872.1.2062 WP_010947872.1.2085 WP_010947872.1.21466 WP_010947872.1.21493 WP_010947872.1.21924 WP_010947872.1.22734 WP_010947872.1.22766 WP_010947872.1.2333 WP_010947872.1.23459 WP_010947872.1.24053 WP_010947872.1.24333 WP_010947872.1.2441 WP_010947872.1.24636 WP_010947872.1.26718 WP_010947872.1.27038 WP_010947872.1.27501 WP_010947872.1.27674 WP_010947872.1.28814 WP_010947872.1.29318 WP_010947872.1.29802 WP_010947872.1.30583 WP_010947872.1.30653 WP_010947872.1.30822 WP_010947872.1.31291 WP_010947872.1.32608 WP_010947872.1.32615 WP_010947872.1.32659 WP_010947872.1.33479 WP_010947872.1.33708 WP_010947872.1.35118 WP_010947872.1.35787 WP_010947872.1.36420 WP_010947872.1.37108 WP_010947872.1.37274 WP_010947872.1.37932 WP_010947872.1.3819 WP_010947872.1.38679 WP_010947872.1.40870 WP_010947872.1.41185 WP_010947872.1.41378 WP_010947872.1.41486 WP_010947872.1.44619 WP_010947872.1.44866 WP_010947872.1.45024 WP_010947872.1.46042 WP_010947872.1.46096 WP_010947872.1.47823 WP_010947872.1.47956 WP_010947872.1.48346 WP_010947872.1.51153 WP_010947872.1.51428 WP_010947872.1.51956 WP_010947872.1.52283 WP_010947872.1.52706 WP_010947872.1.52905 WP_010947872.1.53261 WP_010947872.1.53669 WP_010947872.1.53795 WP_010947872.1.53844 WP_010947872.1.54355 WP_010947872.1.57055 WP_010947872.1.57468 WP_010947872.1.58541 WP_010947872.1.58606 WP_010947872.1.58931 WP_010947872.1.59227 WP_010947872.1.59576 WP_010947872.1.60770 WP_010947872.1.61895 WP_010947872.1.62077 WP_010947872.1.63282 WP_010947872.1.636 WP_010947872.1.64335 WP_010947872.1.64388 WP_010947872.1.64512 WP_010947872.1.64856 WP_010947872.1.66209 WP_010947872.1.66299 WP_010947872.1.68702 WP_010947872.1.69197 WP_010947872.1.70346 WP_010947872.1.71556 WP_010947872.1.73029 WP_010947872.1.73915 WP_010947872.1.74438 WP_010947872.1.75353 WP_010947872.1.75911 WP_010947872.1.76298 WP_010947872.1.76893 WP_010947872.1.77472 WP_010947872.1.77866 WP_010947872.1.79027 WP_010947872.1.79030 WP_010947872.1.79957 WP_010947872.1.80678 WP_010947872.1.80733 WP_010947872.1.80817 WP_010947872.1.81970 WP_010947872.1.82765 WP_010947872.1.83499 WP_010947872.1.8363 WP_010947872.1.84081 WP_010947872.1.85699 WP_010947872.1.86349 WP_010947872.1.86607 WP_010947872.1.87629 WP_010947872.1.87656 WP_010947872.1.88081 WP_010947872.1.89155 WP_010947872.1.89171 WP_010947872.1.90392 WP_010947872.1.90650 WP_010947872.1.91256 WP_010947872.1.91480 WP_010947872.1.93200 WP_010947872.1.94508 WP_010947872.1.9567 WP_010947872.1.96018 WP_010947872.1.96198 WP_010947872.1.97528 WP_010947872.1.97598 WP_010947872.1.97635 WP_010947872.1.98470 WP_010947872.1.98928 YP_096174.1.86292 gi|52842375|ref|YP_096174.1| gi|509151500|ref|YP_008063874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]