SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470182058|ref|YP_007567933.1| from Legionella pneumophila subsp. pneumophila LPE509

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470182058|ref|YP_007567933.1|
Domain Number 1 Region: 12-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000844
Family BCR-homology GTPase activation domain (BH-domain) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|470182058|ref|YP_007567933.1|
Domain Number - Region: 259-330
Classification Level Classification E-value
Superfamily Prefoldin 0.0146
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470182058|ref|YP_007567933.1|
Sequence length 398
Comment hypothetical protein LPE509_01390 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Sequence
MPPPYSTHVIVNVFRCVAQLVSQNPELLNWPGVFRLAGSREESEKLLEQVINDNFSVGNL
ACYILEDGQINNLHLNNVLGMLPLVLKESVLLKTEDPLLKLFMTELKNLLSSEKNNVENT
DAIVQLLSKFIDSLLLSKILDHQRVGEILYHYCYLMHTAGVFYETNLMTWENLAIIMAPH
FTNEFGLYPAEDLLGLIQFTNQLKPILECFIAHPDSGIPFKERHADKLEHLAKTRHTIVE
KLTHMGSESRRIVVAPMKSLMLQASMLRAQIDTVETQSKDSSLKKKDKKELNRQLEKLTE
ELEKLNIEISGLTSKIKKMNHGHAKLKEEIRVISRSEDAVSTHAAQQSGVSSSSSNSVRI
QLGIFGNNSSSSAYLIEEQEEGEVTENEYSGLDSAKLT
Download sequence
Identical sequences A0A1S8GI07 A0A2J9NIH8 G8UWW6 Q5ZUK0
WP_010947524.1.100881 WP_010947524.1.101385 WP_010947524.1.10160 WP_010947524.1.10632 WP_010947524.1.11666 WP_010947524.1.1188 WP_010947524.1.12035 WP_010947524.1.12661 WP_010947524.1.14235 WP_010947524.1.15016 WP_010947524.1.16078 WP_010947524.1.16593 WP_010947524.1.16626 WP_010947524.1.16748 WP_010947524.1.16962 WP_010947524.1.17857 WP_010947524.1.19554 WP_010947524.1.20369 WP_010947524.1.2062 WP_010947524.1.2085 WP_010947524.1.21466 WP_010947524.1.21493 WP_010947524.1.21924 WP_010947524.1.22766 WP_010947524.1.2333 WP_010947524.1.23459 WP_010947524.1.24053 WP_010947524.1.24333 WP_010947524.1.2441 WP_010947524.1.24636 WP_010947524.1.24659 WP_010947524.1.26718 WP_010947524.1.27038 WP_010947524.1.27501 WP_010947524.1.27674 WP_010947524.1.27676 WP_010947524.1.2872 WP_010947524.1.28814 WP_010947524.1.29318 WP_010947524.1.29802 WP_010947524.1.30583 WP_010947524.1.30653 WP_010947524.1.30822 WP_010947524.1.31291 WP_010947524.1.32608 WP_010947524.1.32615 WP_010947524.1.32659 WP_010947524.1.33239 WP_010947524.1.33479 WP_010947524.1.33708 WP_010947524.1.35118 WP_010947524.1.35787 WP_010947524.1.36420 WP_010947524.1.36520 WP_010947524.1.37108 WP_010947524.1.37274 WP_010947524.1.37932 WP_010947524.1.3819 WP_010947524.1.38444 WP_010947524.1.38679 WP_010947524.1.40151 WP_010947524.1.40870 WP_010947524.1.41185 WP_010947524.1.41378 WP_010947524.1.41486 WP_010947524.1.41639 WP_010947524.1.44619 WP_010947524.1.44866 WP_010947524.1.45024 WP_010947524.1.45368 WP_010947524.1.46042 WP_010947524.1.47823 WP_010947524.1.47956 WP_010947524.1.48346 WP_010947524.1.50792 WP_010947524.1.51153 WP_010947524.1.51428 WP_010947524.1.51956 WP_010947524.1.52283 WP_010947524.1.52706 WP_010947524.1.52905 WP_010947524.1.53134 WP_010947524.1.53250 WP_010947524.1.53261 WP_010947524.1.5363 WP_010947524.1.53669 WP_010947524.1.53795 WP_010947524.1.53844 WP_010947524.1.54355 WP_010947524.1.55083 WP_010947524.1.56857 WP_010947524.1.57055 WP_010947524.1.57468 WP_010947524.1.58541 WP_010947524.1.58606 WP_010947524.1.58931 WP_010947524.1.59227 WP_010947524.1.59576 WP_010947524.1.60239 WP_010947524.1.60770 WP_010947524.1.61895 WP_010947524.1.62077 WP_010947524.1.62610 WP_010947524.1.63282 WP_010947524.1.636 WP_010947524.1.64335 WP_010947524.1.64388 WP_010947524.1.64512 WP_010947524.1.64856 WP_010947524.1.65444 WP_010947524.1.66209 WP_010947524.1.66299 WP_010947524.1.66949 WP_010947524.1.67503 WP_010947524.1.68151 WP_010947524.1.68412 WP_010947524.1.68702 WP_010947524.1.69197 WP_010947524.1.70346 WP_010947524.1.70691 WP_010947524.1.7124 WP_010947524.1.71556 WP_010947524.1.72722 WP_010947524.1.73029 WP_010947524.1.7313 WP_010947524.1.73915 WP_010947524.1.74438 WP_010947524.1.75353 WP_010947524.1.75911 WP_010947524.1.76298 WP_010947524.1.76893 WP_010947524.1.77472 WP_010947524.1.77695 WP_010947524.1.77852 WP_010947524.1.77866 WP_010947524.1.79027 WP_010947524.1.79030 WP_010947524.1.79209 WP_010947524.1.79957 WP_010947524.1.80678 WP_010947524.1.80817 WP_010947524.1.81970 WP_010947524.1.82004 WP_010947524.1.82765 WP_010947524.1.83114 WP_010947524.1.83499 WP_010947524.1.8363 WP_010947524.1.84081 WP_010947524.1.84649 WP_010947524.1.85699 WP_010947524.1.86349 WP_010947524.1.86607 WP_010947524.1.87629 WP_010947524.1.87656 WP_010947524.1.88081 WP_010947524.1.88749 WP_010947524.1.89135 WP_010947524.1.89155 WP_010947524.1.89171 WP_010947524.1.90392 WP_010947524.1.90650 WP_010947524.1.91256 WP_010947524.1.91480 WP_010947524.1.93200 WP_010947524.1.93995 WP_010947524.1.9567 WP_010947524.1.96018 WP_010947524.1.96198 WP_010947524.1.97528 WP_010947524.1.97598 WP_010947524.1.97635 WP_010947524.1.97854 WP_010947524.1.98470 WP_010947524.1.98841 WP_010947524.1.98928 WP_010947524.1.99113 WP_010947524.1.99939 YP_095824.1.86292 272624.lpg1798 gi|509151110|ref|YP_008063484.1| gi|52842025|ref|YP_095824.1| gi|470182058|ref|YP_007567933.1| gi|378777659|ref|YP_005186097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]