SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30001439m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30001439m
Domain Number - Region: 3-65
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0199
Family Nuclear receptor ligand-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30001439m
Sequence length 70
Sequence
MHATVRKLMMLHMKSFNPPTYYLKLLRFIKNCLQQWMPCQLTLHKLLFIVIMFLKLNPFS
LSMWVGDGIS
Download sequence
Identical sequences Sakowv30001439m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]