SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30002570m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30002570m
Domain Number 1 Region: 77-91,235-444
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-42
Family Nuclear receptor ligand-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 8-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30002570m
Sequence length 447
Sequence
MGRTLPNPVPCQVCGDKSYGKHYGVYCCDGCSCFFKRSIRRNMVYTCIGKGNCTIDKARR
NWCPYCRLNKCFAVSMNRSAVQEERGPRKNKDPTSSMDKNKTKPDSTSSNVNGAEHPGCD
GKIHSYSPKSRSPDSTEESTSPKPQHSPFQPWKTTSIRTMKMKLEKESSDFRSAFESFRP
ARCQPYPIHGPAVLAANLPNPSTLALGQHIAPRIVTKGSSTSPLDTHLRVGPPPVLVRPI
ALTRQGYQEMLHEIAAQILFTSIKRARSVQTFQTLSFSDQILLLEDCWGELFLLHAAYWP
VDLATLIVQFQGSADTAAGSGFDSLKGGEKWEIEKGATLTSLQETIKKCKVLTLDSNEFA
LLEALILFRTDFKEGLGNTQQVEFLQDQAQLILAQYVNSKTPQNPARFGKLLLTLASLRT
YKSEIIEELFFRKTIGKVPIEAIFGSV
Download sequence
Identical sequences Sakowv30002570m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]