SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30002601m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30002601m
Domain Number 1 Region: 6-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-42
Family G proteins 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30002601m
Sequence length 203
Sequence
MAGSRVDLKVVLLGKEYGGKTSLVERYLHDRFHGDVPYQNVSTIGAAFGAKKVEIGGKMI
TMGIWDTAGSERYEAMSRIYYRGAKAAIICYDLTDYTSFERTRFWVNELKTNEEHCKIYL
SGTKYDLVENDKKNRKVDYHMTTDFADEIHAQVMETSSKTGYHIKELFQKIAEDFVDDPS
NLEIKEPNTLNMYESAYKKKFCC
Download sequence
Identical sequences Sakowv30002601m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]