SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30008304m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30008304m
Domain Number 1 Region: 122-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 45-87
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 79-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 158-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 310-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 6 Region: 235-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 7 Region: 424-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 386-419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 9 Region: 464-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 10 Region: 10-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 11 Region: 274-308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 12 Region: 200-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 13 Region: 350-382
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30008304m
Sequence length 525
Sequence
MNAHRICPDPCPAYECSTGECISTDQLCDGISDCISGEDETNCRCTLAEFTCTDGSCIPL
PYTCDGLVDCSDGGDESTLTCNLTPCTQLQYECSTGECISTEQFCDGVSDCPSGEDETNC
GCTLAEFTCPDGRCIPLSYECDGIVDCQDGSDEQTPLCRACARGEFTCTDGSCIPISYTC
DGIVDCPSEVDESPRICPDPCPAYECSTSECISTDQLCDGISDCISGEDETNCRCTLAEF
TCTDGSCIPISSKCDGIVDCPSEVDENPRTCPDPCPAHECSTGECIANFQICDGIRDCVN
GEDELDCPNVCSEVEFACPQGGCIPLSSLCNGVDDCPSGADENPFRCGRCIHHECRSGEC
IEAHQFCDGTIDCESSEDELDCGTGCLEYEYTCLSGHCISLFRVCDGVPNCATGEDESVD
LCGCNVNQFECDNGKCILGEYVCDGDPDCPYGEDEDDCGCDEAREFTCPTTGACISIIKV
CDGISDCEHGEDERLPECLPTLEPTTPELTIEGNCHILYIHELVN
Download sequence
Identical sequences Sakowv30008304m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]