SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30012192m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30012192m
Domain Number 1 Region: 83-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-50
Family Nuclear receptor ligand-binding domain 0.0000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30012192m
Sequence length 442
Sequence
MSKDAVKFGRIPNREKELAMAEFAENKNDIESTIRRMEEEERQRRIEQNKDLIQSTKPNY
VKRPPPPLISVPAVLPTFKADPEVIEIIQQIREAHSMACPFSELNLKNYTKHSPKRQKIE
YHRSPEPLFLSRRDYSPGFINSPGASSSSSQSSSAAPSPSTSSEVSFSVSSPESLDFSME
NTKVSQAIIAMIKRIVVFSKKLPGFRELFQEDQIILLKGGVFEVWMLQSCNMLLGGSNEC
NDTPYKIDDMSLFCPPNMIEKMVKFAEGFNKFNLTETEIALVSTVALANPDRKGLRNSNP
VGKMQNSFLEALQTELCRYHGVGKGRKLFAEILLKMSDLAVLSEQHAHNARTLKVDSPDL
EVPQLFAEIYDIQEQRNECCDDVLLKCKGVTLNTSFDKLPVELKEYLRQKHERAKKSNSV
KKEMRHLKHCLSYSPDFSPPKT
Download sequence
Identical sequences Sakowv30012192m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]