SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30013216m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30013216m
Domain Number 1 Region: 298-474
Classification Level Classification E-value
Superfamily Lipocalins 6.23e-33
Family Retinol binding protein-like 0.0021
Further Details:      
 
Domain Number 2 Region: 735-890
Classification Level Classification E-value
Superfamily Lipocalins 2.68e-29
Family Retinol binding protein-like 0.0008
Further Details:      
 
Domain Number 3 Region: 975-1151
Classification Level Classification E-value
Superfamily Lipocalins 1.12e-28
Family Retinol binding protein-like 0.00092
Further Details:      
 
Domain Number 4 Region: 68-160,218-284
Classification Level Classification E-value
Superfamily Lipocalins 5.05e-24
Family Retinol binding protein-like 0.0079
Further Details:      
 
Domain Number 5 Region: 516-687
Classification Level Classification E-value
Superfamily Lipocalins 3.43e-17
Family Retinol binding protein-like 0.005
Further Details:      
 
Domain Number 6 Region: 1177-1248
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000131
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 7 Region: 925-963
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 8 Region: 695-730
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  Sakowv30013216m
Domain Number - Region: 26-76
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0008
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30013216m
Sequence length 1267
Sequence
WNTFLHHDDVERWLDNLVIFKSDRRSTIKDIHVTFHKMFGLQLTAITIVCMCAAVLSRPS
SRTLQETCLVDEIQVQEDFQVERYMGTWYEIHRRYTEEIFPDKQLSEYHLRDDGKIGMDI
RGVSMRDACMPVDSLHFIGQAMGEAAAKLTVSMQPPRSGGHGPRPDGQGPGPAHGPPGQH
RPPGQRRGQGPPHGIGTGNSPMFPGGAQQPSIEKEGSYWVLATDYEQYSVVYSCGAVLED
GTCEDGKTMIWVLSRTVHLPDDVIDTIDDIVRSVCVDPAQVNIAPMECTQDIPGRSCRVN
EDIAAQPNFDIERYMGTWYEIAMTKSPLYPNIPNTQKTILSMRDDGNVSVTVSGIMSGPL
CFDLELPGVGYIVDPQDSMAKWLVEMNIPGGFDIGDSGPYWIIETDYDRYAIVYGCNRVL
EDGTCHRNHSSAWLMSRTLHLPDNVKRRLHYTLPLLCMSPSRVRHTPRVDCCNDDISLLA
AAAAGGGSPGAGAPGSGAPGGRPGGPPQVPPEVKKCQVSNLRLQKPFDMESYMGVWYEVA
SHHPGESHEESYIEKLVYTLTLDSIVDIQKTGVKEDGVCTKQPLQNKGRPIISNDAIWRL
KLPNEEPSLLRIVHTDYSRYAVVYFCTQLTPLGTCAEDHAGVHVHARSPSLTDEEQAEVA
LIIGDLCIDTQILEYKTELNDPCTEENSNVEEVSECGEDEFHCNSQECIVTDWVCDRERD
CLDGSDESPERCGPPCIVEDIQLKEDFDIERFTGEWFEIAHNFPGTVSLPDIRSMTYSIT
DDRELTLMMNSVKMHGVCTGHSMPGRGRMNENNPAKLTIAFPHIPKKFGNFSNVRYWVVD
TDYELYAIVYTCMQVNHDGTCNPQSELVWLLSRQEELDEDAHDLAKLVLRDRLCMHRDDL
RDDVGRCPAVVPQERPPPKKPCPRPEIMCTEHEFRCNNGECAPKRWKCDGEVDCGDGSDE
NKETCERNDDIRNHCNVDHFKAQRDFQISEFMGDWFEIAHIKGPRFLKVPDTRSSTFTLR
DSIEPNSYNIEVSLNGLKVRGQCTGRDMSGTGHTLIDQPSKFLLSFPMIPSSFGSYDSVE
YWVMKTDYVSYAITYSCHMQRPDGTCRSDKTMLWVLSRTPTLSDDVRSQLDDDIRDLCVD
PDIVIDSEDPCQPETTDMLVVEEEEEEEDVDDVPKCTQHARTVTRRMNRAKSMGTQIADL
TLPRCDENGNYRRKQCNPFFCRCVVPETGDTVPGTIKRGLDTVDMDCDPGPPVAGGRGRG
NSERGRG
Download sequence
Identical sequences Sakowv30013216m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]