SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30018920m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30018920m
Domain Number - Region: 33-49
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0977
Family Cytochrome c3-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30018920m
Sequence length 69
Sequence
MSVYLHNYFEVFATSPKNQLRLPHTLHRAEFLYSYTTLDFCFYCHQWRCWCGQGNGQKKL
MRHCLCQYS
Download sequence
Identical sequences Sakowv30018920m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]