SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30020572m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30020572m
Domain Number 1 Region: 67-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 123-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30020572m
Sequence length 169
Sequence
MIRSLIIVSVLVYVAAAAVYHASETKQEKEVDSILRDIELKELEGLMLIASKRQWSESVC
AQVSDSRKFNCAGGSPACIPIRHRCDAIIDCDDGSDEVGDECITKHAEDCKSSFKDKQDK
GIEWFECRDNGMCLDKCRKCDGICDCLDQSDDPPALTFIKLTPGNYLLR
Download sequence
Identical sequences Sakowv30020572m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]