SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30020902m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30020902m
Domain Number - Region: 16-65
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0194
Family Transglutaminase, two C-terminal domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30020902m
Sequence length 122
Sequence
MGKNPGEVMFEDENNLKIQHSDDFWEGSDIHVIKETDDTRGEDRYLITTLVGVDVVWNGK
YRIEISIEPSMGSAVVGMCGSANNDSKDDIKTRGGDVISSVDQPDIDNFANTWEVTNSCN
TL
Download sequence
Identical sequences Sakowv30020902m XP_002732547.2.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]