SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30029093m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30029093m
Domain Number - Region: 8-102
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0911
Family Nuclear receptor ligand-binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30029093m
Sequence length 285
Sequence
MMPHYIHPMFDRLKNDDGAKLLQICWNILKQYKAVTLQFLTTGYLEMTKSWICNIDCFDV
ISRVLFITTESNVYEDLKKFNVTNVILLRFKTLQSFSYGQVGYWKYMVYRTGIVYFLLQN
NIPVFITESDAVWFHDAHPAAVDKYHNVDIVAVMNTDNGTTLCGGMVYLNCTSVVKQIWN
KTFEGMEHIIMGHDDDNESMRNGKNDQANFNTAVRGTKHVNIEILPRSAFGGWSPTHPGP
DRIVSHNNYVIGIIHKIKRAKNAGFWFITKNGLSCLNDTCLKLKL
Download sequence
Identical sequences Sakowv30029093m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]