SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30031528m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30031528m
Domain Number 1 Region: 23-126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-16
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 140-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000275
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30031528m
Sequence length 208
Sequence
MPGEQCTFISTTSDQYRVVTVVDENGNYESNVSCKISFRTDESKKFFLRVTRMDMEFSNQ
CVNDSLRIYDGTLDNDRSLTGTAYGICGRSLSLPNYFHSTGNAVSVQFVTDNANNNGEGF
DILVTAYKPVGSTEECEDVDGFLCLDGSKCMSKNVYCNGHSQCSEGSDEPTTCSNVSGRA
SISSFLLAFTVSMTTILFASTKHMTHSQ
Download sequence
Identical sequences Sakowv30031528m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]