SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30032457m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30032457m
Domain Number 1 Region: 523-537,607-830
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-48
Family Nuclear receptor ligand-binding domain 0.000052
Further Details:      
 
Domain Number 2 Region: 454-538
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-26
Family Nuclear receptor 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30032457m
Sequence length 849
Sequence
MSDYSDSKNTQEIMLVAQPKKMRWLKADRNYNSSSVSSACGADSTSECSCKPLLLPTVFS
HPLSVQSLDSVGSSESCESELSHNSLSFPDPSSPEYSSESELCCTNEKERVPIQVTSSQP
FLNDLEICLTNNLNQYSAYSQLSPSWGNQSPQAHPFTDCHRNLNRSMTTVSDSTSTTPTT
TPTKPMPRLLKKVSIKKPTEHRKSPKAATGCEEKEREYFGIRNSSRPCSDLDSANKVVSS
HSINDVHIKDINSAAHTVTKETKRKIQTDLGQLSFNFTKMKEQQMPHDWNHGYCNSYKTG
VSDDSFYRNIFTKVDKYTTVDPDTGEPDVNIADKTVSDVINVKMEISDKEEVSDRKKFES
NRDVELYRSVEPTICTSLEKTQNNRCSPSSNENDAYEFSETISNGQDTDTQSTLITVIKN
IKKEPEDTYECQNVSDKIPLMLDEAERGQILKGPCPVCGDKISGYHYGIFSCESCKGFFK
RTVQNKRHERLRCALNNKCEISLANRKRCASCRFQKCLHQGMKLEAIRTDRQRGGRSLYE
GSSEFKRKLLLAKQDKAKPKPKKKRVSSHKFMNKKSLEVSIADSLASSSSNSCSDISSPA
PTTKPQISPFFTELLEKQRFLFQTSDCSICKETNIENLKDMTIFLHFADHQLFSLVSWAR
TLPYFKEIKTADQIKLLQSAWCQAFITTLAYLSIPHNDHIMFITGKLVDKDEANRYHVLE
VFQRLLDFTQHLKRLEIDKYEIEAFKLMLLLRSDCQNLSRPDQVTELQEKVEDELLTYIT
EQYPERPNKFAELIVRISEIERICYIVKELVMFKQLSSGVSDDSLLNELMEESSKIDRVV
PKTISLPLP
Download sequence
Identical sequences Sakowv30032457m XP_006814373.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]