SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30036157m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30036157m
Domain Number 1 Region: 25-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.05e-23
Family G proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30036157m
Sequence length 185
Sequence
LTVRFLTRRFIGEYENSAGMSRDLSRIDVTYNARIVQPHYKYRHMISLGDEIIHLEILDA
RSQNVLSNDVIRWADGVCLVYSITDLSSFWTIRTWAHKIRECRKNSVCEFILVGNKKDLS
HFRKISTENGRALASELECPFFEVSAAEDYQSICDALYELYQEVTSYKSRRKMSILGRVF
RNSHK
Download sequence
Identical sequences Sakowv30036157m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]