SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30038454m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30038454m
Domain Number 1 Region: 111-122,246-481
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-66
Family Nuclear receptor ligand-binding domain 0.000000513
Further Details:      
 
Domain Number 2 Region: 39-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-30
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30038454m
Sequence length 485
Sequence
MTAEIDKSTPPKETRSGQAPTLKMDFAFENEELKVAFDDMCPVCGDKVSGYHYGLLTCES
CKGFFKRTVQNKKVYTCIENRNCVIDKTQRKRCPYCRFQKCLKVGMKLEAVRPDRMRGGR
NKFGPMYKRDRAMKQQQRNRVMVSTRPLNVPGNPEISNAIRNIQAAAAAKNCTQSSVAPQ
PAMVIRDPLNTPKPTLSDIPRPVASIPVSYGYDVTGGVSQLMGSMSGPLMSEPKSTYSAA
VPNPIKVEPDQTPRLITEMVRSEPDYKQLQAKIRTCLQSQMEMNGPTDYFGMACKLADQT
LFAFVDWARNSMFFKDLKVEDQMKLLQNAWSELLVIDQCYRQVESNVEEMILVTGEVLDV
AKLRMYGLGDIVDRMTEIIKRMKELKMDRKEFMCLKFLLLLNPDVPGLQDNHAIRQFQEQ
IHAALLDYTMSNYPEVTEKFGQLLLRLPEIRQISLQGEEYLYYKHLSGEVPYNSLLMEML
HSKRK
Download sequence
Identical sequences XP_006813239.1.86028 Sakowv30038454m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]