SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30001832m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30001832m
Domain Number 1 Region: 139-319
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.000000000000149
Family Pce catalytic domain-like 0.071
Further Details:      
 
Domain Number 2 Region: 52-127
Classification Level Classification E-value
Superfamily ISP domain 0.00000000799
Family Ring hydroxylating alpha subunit ISP domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30001832m
Sequence length 642
Sequence
MQQEAITVLRLTQKETEDLKVGVNLVNGPSDKKFAIYRPAELTDGEEGENIGIRACMNIC
KHQGGTFIKDIEDLDSSVLRCTKHGWRLDCQTMQYVNPPNSFRQEELIPEFGEDGGLKLV
ELRPPQPWQQDPRNALEIKPGEVEVTYFSHACVEMKLGEVRMFTDPWLTGPAFARGWWLL
HEPPCDWLDRLASTDFIYISHLHSDHLSYPTLEQLYKRNPDVPIYVGDVSTPVFSKMEEH
GVKMNNITVLEFGVWKEINADLRFMILMDGVHPELDTCLLIDYKGHFILDTVDCTNPNGG
RLPHNVDVMMSDFAGGAAGFPMTFHGGKYTEDWKRNFIKSERRKLLYYKTQVVRKVNPVV
YFPFAGYFVEAHPSDKYIKDTNAKISPNALNDLINKHSPDIKTWTPLPGSMFDLGKILKD
KDDITAFRDPPPGTKILKDDWDFDKYLDAIDASIYNEIFAYPEWVEFYYKWCQFKNYNLV
VKMIETDDNFQPIEGAYTYMVDFVGEVPTFPSERPDRTHNYLEIRNRIGVHRQTMLTGMF
WDDLYIGFNNRITRDPDTFHYQFWNYMQVLLPQEPPKWEEFLEEQRAKGARGRSVWAPSN
KALIKGTTRVPQSYSSILCTAALSMAVGVAAAVALRILVRSR
Download sequence
Identical sequences A0A0U2U2F9
XP_006813034.1.86028 XP_006813035.1.86028 Sakowv30001830m Sakowv30001831m Sakowv30001832m Sakowv30001833m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]