SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30002433m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30002433m
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.44e-29
Family Cap-Gly domain 0.00087
Further Details:      
 
Domain Number 2 Region: 133-369
Classification Level Classification E-value
Superfamily L domain-like 3.4e-24
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 3 Region: 442-526
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-17
Family Ubiquitin-related 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30002433m
Sequence length 528
Sequence
MANVTVGSRFVSDGNYGTVKYIGEVPPTAGEWLGVEWDEPERGKHDGMHEGHRFFHTNHP
TSGSFIRLKKAEFGISYCEALVERYGMPDDEDMGIEKSEWFFKTYGNKQKAVEMVGAQSV
AKLQSQYEKLSDVALREMRISSAGAEGHIEKTSPNVTELDLSKNLLSSLEQVANITKQMK
SLKTLKLSENRLQLPLQSTKLDTAFQNVSELFLNYMKLTWKDIVQLSPVLPSLKNLHVCF
NDISTIPRLDNSFESLELLNLESNNIADWKSVQHLGQLPRLSSLILNMNSIPEISFKETA
CGEKTKLFPALKSISLNDNKLSSWRDVNELNKLTGLEEIRLKRNPLLKDQKYFNVRQLII
TKIETLKLCNGSEVPDIERKTAELDYLKRFGQEWLDSGGSQDLAINRPSDDFKINHPRYH
RLLELYGAPESSEFSAAPSTALKNTLIKVTIVCPQKPEIKAVSKKLPGSMTVQKVKNLIS
RIFKVDTTDQQLAYISKKMGGPEVELESDLRQLSYYSLENEDTIVIKF
Download sequence
Identical sequences Sakowv30002433m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]