SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30005910m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30005910m
Domain Number 1 Region: 491-812
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.13e-52
Family Rhodopsin-like 0.00065
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily L domain-like 1.19e-48
Family Internalin LRR domain 0.035
Further Details:      
 
Domain Number 3 Region: 232-420
Classification Level Classification E-value
Superfamily L domain-like 2.3e-31
Family Internalin LRR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30005910m
Sequence length 907
Sequence
MFSRRCNCNKKLADNSISELPALVFHGLNKLKVLNLEVNQLQVVPPEALKNLQELESLNL
DANKIKEVPATSFQGLISLKYLWLAANYMNDVPTEALSLCHSLEALTLALNNISLIKDYA
FINMTKLNALLLQENIIRILGDHAFDGLDHLTHLDLNLNQITEFPVALSVLSRLKELDLQ
RNRISYIRDNAFSGNPELKIVELLGNSIRSVGKYAFSNMPKLEKLALSTAKDLKEFPDLT
GTSSISGLHLDRCSIQSVPDDLCIQLPNLKSLDLHSNPIQTIPNLSECNELRIINLGGTA
ITSLEGKPFIGLFKLRDLTLNNNYITIIPEDAFVGLTDLQYLDLQRSAIEEIHPNAFAPL
KHLENLNLSENKFRVLPTVGLKKLVFLKTQGTETLHDFPSAKSFPQITRLYLEYEYHCCE
FLQMEEESEDPLSAITESFEWLSSHAEINNVSLEHFTDISDVMNIDYNYNMENDNIELDS
DFYNDDFTIGDFEDISAYNNNPIECLPYPTPFTPCDDLFGWWALRCGVWVVFLLALFGNG
TVIFVIVVSRTKMCVPRFLICNLACADFCMAIYLGFLAIIDASTLGDFKKHAVIWQHSSG
CQIAGFLAVLSSELSVFTLAVITMERNYAITHAMHLNKRLSLKTASIVMAGGWLLSLFCA
TLPLVGFSSYTKFAICLPFETSPARSLGFVMGIMTLNALAFVIIVGCYLKMYCSILGSQA
WNSNDSRVAKRMALLVFTDFACWAPIAFFSITSMFHTPLISLDGAKVLTIFVLPLNSCAN
PFLYAIFTNQFKKDCSMICRRLEERSVLTSRSVIKMSNSRNQYSSSVQSSRRLSVNDKNH
HSNSNESVPTNCNYQQLAVKQNNDYQSSLPFKDDKDTCENLLESIKSFGDIPLVMQKNNC
QESDGDC
Download sequence
Identical sequences Sakowv30005910m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]