SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30006552m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30006552m
Domain Number 1 Region: 21-364
Classification Level Classification E-value
Superfamily L domain-like 3.23e-40
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 2 Region: 360-710
Classification Level Classification E-value
Superfamily L domain-like 1.87e-38
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 3 Region: 806-946
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.05e-22
Family Toll/Interleukin receptor TIR domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30006552m
Sequence length 962
Sequence
MYRLLLLLSAAILNTAGCRGNIMCHCDYKNMLLVDCGGNSLTSVPDDVPNKESLTSLWLD
KNNFRCVQQDMFKGFQKLRNLWLDSSNVHELEVRAFWEIKGLHQLYLRDNNILNIDEDNF
SGLEQLTSLDLRNNPVQSIQNSAFKDLVNLNALNFSDCNLTTLHSGILRGLTKLEVLKFE
RCNISAIMNETFDALINLKILSLHGNQLRNIDGKLFHSLTIQTLDVSCNLLRGAIGNLCN
NVQSVERLNYEKNLFTTIKFDESYSKCRNLTYLNIANVANSISVMGNTFQGLKTINITEL
DFHGNKMKDLDPDALTSFENPILLNLGSTNIRTDFTRTFETLLTKNKLKTHSLLLNDISH
LSNILLQSHHNIVQNVWLRDLDLSDNQIPRLVERMFQWCPLIKKLNLMSNSITNVAVNTF
LGLEYLTELDLSDNYIWNIKADTFKNSQLIELNLSNNILVFVGFEGLKKLKKLKLSDQGK
VRIVKEQFIKLESLEELDISYNFWGSSFQLPLCNLTSLKKLNISMTTIENDMRNFSIDDM
SETCSTFVSELTHLDFSMSYVDNMHQIERYFYKNRKALINLKTLNISSLLHAESYKYFPW
NIFTELINLKELQLQNNHIGNHLLPRSDPFSKLTNLQTLDASGNRITNIAAWKGLLNIQK
LGLHDNWFDVVETETFSDMKNLESLYLHGSQFDCGCTIDRFHRFLKKHTTIWTSEAAAYD
GRPFWFQNYNCSEPKMTYVIDAYSSPWKCDKILIVLVTFAIITACMGLSFLLYKFCRYEI
RYIWFVVRLKLNCVRHAEHTNLINLDEYDYDVHISYNITDENWVIDHLLPFLENHLQIRV
HINDRDMRGGVNRLSYASNLILKRTRKIMFVLSDNFVQDKYCMLELQLAFEKLFNDHENI
MVFANLERINKNLQPLMLRLPICKKRQNKWYRYNEITRDAFWNDLKESIAENGSVNHTVQ
LL
Download sequence
Identical sequences Sakowv30006552m XP_006823648.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]