SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30008104m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30008104m
Domain Number 1 Region: 46-268
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-46
Family Nuclear receptor ligand-binding domain 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30008104m
Sequence length 273
Sequence
MPREERLKILHELKKEASCATWEEKRKIELRQFTDSIHQSFREIFKQYRGSRQLKEKSNG
FLGYGILPMREMYDRDEICEVLRHWATTVVEKVARFAKEALPDFRALQLGDQVTLLKYAA
FEIYLIMASSRYTADGLWFPEHGVFIKRETLDALQIQNLFESKFKFYDKINRMYLTEREV
ALFCALSLASPDREDLSDRTKVENFQEYLVECLQMELKQNHPDNPMMLPRVVARLVEMRQ
LMPEHVQSLQNQPPGAMVPTPLLREIFGLSNTV
Download sequence
Identical sequences Sakowv30008104m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]